PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan014424
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family EIL
Protein Properties Length: 509aa    MW: 57625.4 Da    PI: 6.5166
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-101836PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3484.85e-14843651353
                XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
       EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekve 100
                eel++rmw+d+ml +rlke++k     ke  ++ +k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv gasd+Lr+WWk kv+
  Aan014424   4 EELERRMWRDKMLYRRLKEQNKC----KEG-VDIAKQKQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVGGASDNLREWWKTKVR 98 
                8******************9996....787.9******************************************************************** PP

                XXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG CS
       EIN3 101 fdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphd 200
                fdrngpaaisky a++ ++++++s  t   s++h+l+elqDTtlgSLLsalmqhc+ppqrrfplekgv+pPWWP+G+e ww e g++++qg+ppykkphd
  Aan014424  99 FDRNGPAAISKYCADHSVPGENESP-T-LVSTPHTLQELQDTTLGSLLSALMQHCNPPQRRFPLEKGVAPPWWPKGDEGWWVESGMPREQGPPPYKKPHD 196
                ******************9977776.4.79********************************************************************** PP

                --HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XXXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXX CS
       EIN3 201 lkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ssslrkqspkvtlsceqkedvegkkeskikhvqav 298
                lkk+wkv vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee +c++++++  ++ +  +  ++ +++ +++dveg  ++ i + + +
  Aan014424 197 LKKVWKVNVLTAVIKHMSPNIDKIRKLVRQSKCLQDKMTAKESATWLAIINQEETLCQNLYPNscPPATGGGIGSYLINETSDYDVEGAIDEPILELEDC 296
                ***************************************************************654566779***************999999999**** PP

                XXXX................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
       EIN3 299 ktta................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                k ++                + ++  krk+++ e+  ++ k  ++ c+  q+++++++l+f +++++++++
  Aan014424 297 KPQNpyglvkvkgevvdltnTDNFMMKRKQPSYENPHMEPK--MYVCEYPQCPYNDVRLGFYNRSARNNHQ 365
                *999***************9889999***999999999999..7*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.2E-1264250No hitNo description
Gene3DG3DSA:1.10.3180.101.7E-72126260IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.66E-60129252IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MDIEELERRM WRDKMLYRRL KEQNKCKEGV DIAKQKQSQE QARRKKMSRA QDGILKYMLK  60
MMEVCKAQGF VYGIIPEKGK PVGGASDNLR EWWKTKVRFD RNGPAAISKY CADHSVPGEN  120
ESPTLVSTPH TLQELQDTTL GSLLSALMQH CNPPQRRFPL EKGVAPPWWP KGDEGWWVES  180
GMPREQGPPP YKKPHDLKKV WKVNVLTAVI KHMSPNIDKI RKLVRQSKCL QDKMTAKESA  240
TWLAIINQEE TLCQNLYPNS CPPATGGGIG SYLINETSDY DVEGAIDEPI LELEDCKPQN  300
PYGLVKVKGE VVDLTNTDNF MMKRKQPSYE NPHMEPKMYV CEYPQCPYND VRLGFYNRSA  360
RNNHQLNCAY RPITNPTGGT LNFQMNNLEK PPVFSMPSFS QTKVATVPQP FNHAAPPVAS  420
YGVISELGLP EDDQKIIADL MSFYDNNLQQ TDPIQLEDDG FFATNIESTT GFDFADGKMP  480
FDAGLDSGNS LNGNDSNTLD FRFGAQPAW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A5e-761272601134Protein ETHYLENE INSENSITIVE 3
4zds_B5e-761272601134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Aan.99937e-84trichome
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002276380.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
RefseqXP_010659025.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLF6HIW50.0F6HIW5_VITVI; Putative uncharacterized protein
STRINGVIT_13s0047g00250.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein